PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00112456001
Common NameGSBRNA2T00112456001, LOC106358358
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 221aa    MW: 23304.8 Da    PI: 9.0088
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00112456001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.41.4e-372383262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++++l+cprC+stntkfCyynny+ sqPr+fCkaCrryWt+GG+lr++PvGg +rk+ k+s
  GSBRNA2T00112456001 23 QQDQLPCPRCESTNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDIPVGGVSRKSSKRS 83
                         57889***************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-32275IPR003851Zinc finger, Dof-type
PfamPF027016.3E-332581IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5842781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MPSDVNESRR LTKIPHGGAA ADQQDQLPCP RCESTNTKFC YYNNYNFSQP RHFCKACRRY  60
WTHGGTLRDI PVGGVSRKSS KRSRTCSSVA VSAAVGSREF PLQATPVLFP PPSSNNGDVT  120
AAKGSASSVY GGFTSLLSYN AAASRNGPGG GFNGLEGFGL GLGHGSYFDN VRFGQGITVW  180
PFSSSATDAT SAVTSHVGPI PATWQFEGPE SKVGFVSGDY *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.253790.0flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00112456001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013653583.11e-162PREDICTED: dof zinc finger protein DOF5.8-like
SwissprotQ9FGD61e-117DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLA0A078EH841e-162A0A078EH84_BRANA; BnaA07g12230D protein
STRINGBra012119.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.12e-92Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]